PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC08G10970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 179aa    MW: 20030.3 Da    PI: 8.9647
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC08G10970.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_151.62e-163696363
                     XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                     +lkr rrk++NR +A+rsR+RK++ ++ L+  v +L+ eN++L  +l++ ++ +a+ +s++
  OPUNC08G10970.1 36 DLKRKRRKESNRQSAKRSRLRKQQHLDDLTSQVNQLKMENQQLTTTLNMVTQSYAAAESQN 96
                     79*****************************************************999887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1702.1E-133090No hitNo description
SMARTSM003385.0E-183498IPR004827Basic-leucine zipper domain
PfamPF001703.5E-133696IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.4383699IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.94E-123790No hitNo description
CDDcd147026.00E-203990No hitNo description
PROSITE patternPS0003604156IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MTLSGGTLSS GTTSGSSHGS RSSGSEDDIQ LQAQMDLKRK RRKESNRQSA KRSRLRKQQH  60
LDDLTSQVNQ LKMENQQLTT TLNMVTQSYA AAESQNSVLR TQMMELDSRL SALREIIFYM  120
NNGNQLPSNS TIAATTYPST TMTAATTGHY DYYDVFTANA WGSGMQMMQQ PIDQFLYQC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13742KRKRRK
23843RKRRKE
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1005801e-149AK100580.1 Oryza sativa Japonica Group cDNA clone:J023105M12, full insert sequence.
GenBankAP0055201e-149AP005520.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0426E02.
GenBankAP0149641e-149AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
GenBankCP0126161e-149CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015651067.11e-109PREDICTED: ocs element-binding factor 1
TrEMBLA0A0E0LU531e-130A0A0E0LU53_ORYPU; Uncharacterized protein
STRINGLOC_Os08g26880.11e-109(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP37403276
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.15e-27basic leucine-zipper 44